.
The Open Protein Structure Annotation Network
PDB Keyword
.

3dls

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of human PAS kinase bound to ADP. To be Published
    Site NYSGXRC
    PDB Id 3dls Target Id NYSGXRC-9501a
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS24501,PF00069, AAK69752 Molecular Weight 142851.20 Da.
    Residues 1323 Isoelectric Point 4.76
    Sequence medggltafeedqrclsqslplpvsaegpaaqttaepsrsfssahrhlsrrnglsrlcqsrtalsedrw ssyclsslaaqnictsklhcpaapehtdpseprgsvsccsllrglssgwsspllpapvcnpnkaiftvd aktteilvandkacgllgyssqdligqkltqfflrsdsdvvealseehmeadghaavvfgtvvdiisrs gekipvsvwmkrmrqerrlccvvvlepvervstwvafqsdgtvtscdslfahlhgyvsgedvagqhitd lipsvqlppsgqhipknlkiqrsvgrardgttfplslklksqpsseeattgeaapvsgyrasvwvfcti sglitllpdgtihginhsfaltlfgygktellgknitflipgfysymdlaynsslqlpdlascldvgne sgcgertldpwqgqdpaeggqdprinvvlagghvvprdeirklmesqdiftgtqteliaggqllsclsp qpapgvdnvpegslpvhgeqalpkdqqitalgreepvaiespgqdllgesrsepvdvkpfascedseap vpaedggsdagmcglcqkaqlermgvsgpsgsdlwagaavakpqakgqlaggsllmhcpcygsewglww rsqdlapspsgmaglsfgtptldepwlgvendreelqtclikeqlsqlslagaldvphaelvptecqav tapvsscdlggrdlcggctgsssacyalatdlpggleaveaqevdvnsfswnlkelffsdqtdqtssnc scatselretpsslavgsdpdvgslqeqgscvlddrelllltgtcvdlgqgrrfrescvghdpteplev clvssehyaasdrespghvpstldagpedtcpsaeeprlnvqvtstpvivmrgaaglqreiqegaysgs chhrdglrlsiqfevrrvelqgptplfccwlvkdllhsqrdsaartrlflaslpgsthstaaeltgpsl vevlrarpwfeeppkaveleglaacegeysqkystmsplgsgafgfvwtavdkeknkevvvkfikkekv ledcwiedpklgkvtleiailsrvehaniikvldifenqgffqlvmekhgsgldlfafidrhprldepl asyifrqlvsavgylrlkdiihrdikdeniviaedftiklidfgsaaylergklfytfcgtieycapev lmgnpyrgpelemwslgvtlytlvfeenpfceleetveaaihppylvskelmslvsgllqpvperrttl eklvtdpwvtqpvnladytweevcrvnkpesgvlsaaslemgnrslsdvaqaqelcggpvpgeapngqgclhpgdprllts
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 6
    Resolution (Å) 2.30 Rfree 0.297
    Matthews' coefficent 2.56 Rfactor 0.241
    Waters 280 Solvent Content 51.93

    Ligand Information
    Ligands ADP (ADENOSINE-5'-DIPHOSPHATE) x 6
    Metals MG (MAGNESIUM) x 19

    Jmol

     
    Google Scholar output for 3dls
    1. Comparison of structure_based and threading_based approaches to protein functional annotation
    M Brylinski, J Skolnick - Proteins: Structure, Function, and , 2010 - Wiley Online Library
     
    2. FunFOLD: an improved automated method for the prediction of ligand binding residues using 3D models of proteins
    D Roche, S Tetchner, L McGuffin - BMC bioinformatics, 2011 - biomedcentral.com
     
    3. Structural bases of PAS domain-regulated kinase (PASK) activation in the absence of activation loop phosphorylation
    CK Kikani, SA Antonysamy, JB Bonanno - Journal of Biological , 2010 - ASBMB
     
    4. Human Mutation within Per-Arnt-Sim (PAS) Domain-containing Protein Kinase (PASK) Causes Basal Insulin Hypersecretion
    F Semplici, M Vaxillaire, S Fogarty, M Semache - Journal of Biological , 2011 - ASBMB
     
    5. A New Library of Surface Patches: Design and Applications
    R Gamliel, K Kedem, R Kolodny, C Keasar - 2009 - cs.bgu.ac.il
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch