.
The Open Protein Structure Annotation Network
PDB Keyword
.

3dmy

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of a predicted Acyl-CoA-synthetase from E.coli. To be Published
    Site NYSGXRC
    PDB Id 3dmy Target Id NYSGXRC-10300a
    Molecular Characteristics
    Source Escherichia coli
    Alias Ids TPS20464,PF06263, Q47208 Molecular Weight 58592.60 Da.
    Residues 555 Isoelectric Point 5.07
    Sequence mihafikkgcfqdsvslmiisrklsesenvddvsvmmgtpankalldttgfwhddfnnatpndicvair seaadagiaqaimqqleealkqlaqgsgssqaltqvrrwdsacqklpdanlalisvageyaaelanqal drnlnvmmfsdnvtledeiqlktrarekgllvmgpdcgtsmiagtplafanvmpegnigvigasgtgiq elcsqialagegithaiglggrdlsrevggisaltalemlsadeksevlafvskppaeavrlkivnamk atgkptvalflgytpavardenvwfassldeaarlacllsrvtarrnaiapvssgficglytggtlaae aagllaghlgveaddthqhgmmldadshqiidlgddfytvgrphpmidptlrnqliadlgakpqvrvll ldvvigfgatadpaaslvsawqkacaarldnqplyaiatvtgterdpqcrsqqiatledagiavvsslp eatllaaalihplspaaqqhtpsllenvaviniglrsfalelqsaskpvvhyqwspvaggnkklarllerlq
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.07 Rfree 0.270
    Matthews' coefficent 2.39 Rfactor 0.237
    Waters 362 Solvent Content 48.59

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3dmy
    1. Adenylate-forming enzymes
    S Schmelz, JH Naismith - Current opinion in structural biology, 2009 - Elsevier
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch