.
The Open Protein Structure Annotation Network
PDB Keyword
.

3do9

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of Protein Ba1542 from Bacillus Anthracis Str.Ames. To be Published
    Site NYSGXRC
    PDB Id 3do9 Target Id NYSGXRC-10418f
    Molecular Characteristics
    Source Bacillus anthracis
    Alias Ids TPS9412,YP_027699, BIG_50 Molecular Weight 21430.55 Da.
    Residues 178 Isoelectric Point 6.71
    Sequence mntpvsvnekkdfvkwflnnyqlkqrecvwilnylmshdqlmhkvhfvehakycprglvmsancvkdtp fhffkqnvmttdaeksfhdirlnrdediyiqlnfkssfqnanyvavleenpylpkhievnekdrllaer fleesvfsfrrerllkqidealdkqdkeafhrltaelkml
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.75 Rfree 0.31204
    Matthews' coefficent 3.51 Rfactor 0.26378
    Waters 9 Solvent Content 65.00

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3do9
    1. Assessment of CASP8 structure predictions for template free targets
    M Ben_David, O Noivirt_Brik, A Paz - Proteins: Structure, , 2009 - Wiley Online Library
     
    2. The Fragment-based Consistency Score in Model Quality Assessment for De Novo Prediction of Protein Structures
    H Cetin, TN Sasaki, M Sasai - Chem-Bio Informatics Journal, 2011 - J-STAGE
     
    3. ___________________________________
    H Cetin_ _____ ____ - CBI _____, 2011 - J-STAGE
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch