.
The Open Protein Structure Annotation Network
PDB Keyword
.

3dou

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of Methyltransferase Involved in Cell Division from Thermoplasma Volcanicum. To be Published
    Site NYSGXRC
    PDB Id 3dou Target Id NYSGXRC-11117o
    Molecular Characteristics
    Source Thermoplasma volcanium
    Alias Ids TPS9409,NP_110808.1, 3.40.50.150 Molecular Weight 22602.72 Da.
    Residues 197 Isoelectric Point 9.11
    Sequence mtgdrrdeyywkakkeqlrsraafkleflldryrvvrkgdavieigsspggwtqvlnslarkiisidlq emeeiagvrfircdifketifddidralreegiekvddvvsdamakvsgipsrdhavsyqigqrvmeia vrylrnggnvllkqfqgdmtndfiaiwrknfssykiskppasrgssseiyimffgfkap
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.45 Rfree 0.19456
    Matthews' coefficent 1.99 Rfactor 0.16566
    Waters 152 Solvent Content 38.28

    Ligand Information
    Ligands SAM (S-ADENOSYLMETHIONINE) x 1
    Metals

    Jmol

     
    Google Scholar output for 3dou
    1. Comparison of structure_based and threading_based approaches to protein functional annotation
    M Brylinski, J Skolnick - Proteins: Structure, Function, and , 2010 - Wiley Online Library
     
    2. Riboswitches: structures and mechanisms
    AD Garst, AL Edwards, RT Batey - Cold Spring Harbor , 2010 - cshperspectives.com
     
    3. Molecular modeling and in silico characterization of Mycobacterium tuberculosis TlyA: Possible misannotation of this tubercle bacilli-hemolysin
    NE Arenas, LM Salazar, CY Soto - BMC structural , 2011 - biomedcentral.com
     
    4. A New Library of Surface Patches: Design and Applications
    R Gamliel, K Kedem, R Kolodny, C Keasar - 2009 - cs.bgu.ac.il
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch