The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title CRYSTAL STRUCTURE OF SAM-dependent methyltransferase from Bacteroides vulgatus ATCC 8482. To be Published
    Site NYSGXRC
    PDB Id 3dp7 Target Id NYSGXRC-11126e
    Molecular Characteristics
    Source Bacteroides vulgatus
    Alias Ids TPS14659,YP_001298330.1, Molecular Weight 40572.30 Da.
    Residues 356 Isoelectric Point 5.54
    Sequence mmhkrytkeqctaaeaqrlaqeiafgpvvfqvsrlmlkfgifqllsgkregytlqeisgrtgltryaaq vlleasltigtilleedryvlakagwfllndkmarvnmefnhdvnyqglfhleeallngrpeglkvfge wptiyeglsqlpeqvqkswfgfdhfysdqsfgkaleivfshhpkrlldiggntgkwatqcvqynkevev tivdlpqqlemmrkqtaglsgserihghganlldrdvpfptgfdavwmsqfldcfseeevisiltrvaq sigkdskvyimetlwdrqryetasycltqislyftamangnskmfhsddlircienagleveeiqdnig lghsilqcrlk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.33 Rfree 0.253
    Matthews' coefficent 3.66 Rfactor 0.183
    Waters 90 Solvent Content 66.37

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch