.
The Open Protein Structure Annotation Network
PDB Keyword
.

3dtd

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of Invasion Associated Protein B from Bartonella Henselae. To be Published
    Site NYSGXRC
    PDB Id 3dtd Target Id NYSGXRC-10036a
    Molecular Characteristics
    Source Bartonella henselae
    Alias Ids TPS20458,Q6G4Y3, PF06776 Molecular Weight 19996.31 Da.
    Residues 186 Isoelectric Point 9.30
    Sequence mkklfnlfifftllsissvafasnskstttkdtvatlpngassltetyglwsincgiqegkkvcfmhrq evndqnrvvvamsvvlnadgvvsgnltvpfgilvskpvrlqvdegkavietgirtcvpagcivpivfdk nyvaalragkhlklamtiaapgepplndlfvqlngfsnalnrlialqk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 12
    Resolution (Å) 2.35 Rfree 0.26524
    Matthews' coefficent 2.66 Rfactor 0.23501
    Waters 416 Solvent Content 53.75

    Ligand Information
    Ligands GOL (GLYCEROL) x 18
    Metals

    Jmol

     
    Google Scholar output for 3dtd
    1. Intruders below the Radar: Molecular Pathogenesis of Bartonella spp.
    A Harms, C Dehio - Clinical Microbiology Reviews, 2012 - Am Soc Microbiol
     
    2. A New Library of Surface Patches: Design and Applications
    R Gamliel, K Kedem, R Kolodny, C Keasar - 2009 - cs.bgu.ac.il
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch