.
The Open Protein Structure Annotation Network
PDB Keyword
.

3dtn

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of putative Methyltransferase-MM_2633 from Methanosarcina mazei. To be published
    Site NYSGXRC
    PDB Id 3dtn Target Id NYSGXRC-11121c
    Molecular Characteristics
    Source Methanosarcina mazei
    Alias Ids TPS20432,PF08242, NP_634657.1, 3.40.50.150 Molecular Weight 26166.32 Da.
    Residues 225 Isoelectric Point 5.04
    Sequence mseikrkfdavsgkydeqrrkfipcfddfygvsvsiasvdtenpdildlgagtgllsaflmekypeatf tlvdmsekmleiaknrfrgnlkvkyieadyskydfeekydmvvsalsihhlededkkelykrsysilke sgifinadlvhgetafienlnktiwrqyvensglteeeiaagyerskldkdiemnqqlnwlkeagfrdv sciykyyqfavmfgrktv
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.09 Rfree 0.234
    Matthews' coefficent 2.37 Rfactor 0.187
    Waters 135 Solvent Content 48.00

    Ligand Information
    Ligands ACT (ACETATE) x 2
    Metals CA (CALCIUM) x 2

    Jmol

     
    Google Scholar output for 3dtn
    1. Exploring Symmetry as an Avenue to the Computational Design of Large Protein Domains
    C Fortenberry, EA Bowman, W Proffitt - Journal of the , 2011 - ACS Publications
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch