.
The Open Protein Structure Annotation Network
PDB Keyword
.

3dty

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of an Oxidoreductase from Pseudomonas syringae. To be Published
    Site NYSGXRC
    PDB Id 3dty Target Id NYSGXRC-11131g
    Molecular Characteristics
    Source Pseudomonas syringae pv. tomato
    Alias Ids TPS20436,3.40.50.720, AAO56509.1 Molecular Weight 42959.30 Da.
    Residues 389 Isoelectric Point 5.63
    Sequence mingsrripqpirwamvgggsqsqigyihrcaalrdntfvlvagafdidpirgsafgeqlgvdsercya dylsmfeqearradgiqavsiatpngthysitkaaleaglhvvcekplcftveqaenlrelshkhnriv gvtygyaghqlieqaremiaagelgdvrmvhmqfahgfhsapveaqsqatqwrvdprqagpsyvlgdvg thplylsevmlpdlkikrlmcsrqsfvasraplednaytlmeyeggamgmvwssavnagsmhgqkirvi gsraslewwderpnqlsfevqgqpaqilergmgylhpnaliddriggghpeglfeawanlyyrfalamd atdrsdtqalsavrypgidagvegvrwvercvlsadndsiwvay
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.04 Rfree 0.2177
    Matthews' coefficent 2.35 Rfactor 0.1925
    Waters 897 Solvent Content 47.67

    Ligand Information
    Ligands
    Metals MG (MAGNESIUM) x 4

    Jmol

     
    Google Scholar output for 3dty
    1. A novel _-N-acetylgalactosaminidase family with an NAD+-dependent catalytic mechanism suitable for enzymatic removal of blood group A antigens
    G Sulzenbacher, QP Liu, EP Bennett - Biocatalysis and , 2009 - informahealthcare.com
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch