The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of the N-terminal domain of a putative aldolase (BVU_2661) from Bacteroides vulgatus. To be Published
    Site NYSGXRC
    PDB Id 3dxi Target Id NYSGXRC-11107n
    Molecular Characteristics
    Source Bacteroides vulgatus
    Alias Ids TPS20428,, YP_001299935.1 Molecular Weight 57699.74 Da.
    Residues 510 Isoelectric Point 6.48
    Sequence mkildctlrdggyytnwdfnskivdayilamnelpidylevgyrnkpskeymgkfgytpvsvlkhlrni stkkiaimlneknttpedlnhlllpiiglvdmiriaidpqnidraivlakaiktmgfevgfnvmymskw aemngflsklkaidkiadlfcmvdsfggitpkevknllkevrkythvpvgfhghdnlqlglinsitaid dgidfidatitgmgrgagnlkmellltylnkhhglnvdfnvlgniittftpllekyqwgtnlpymlsga nnipqkevmdwvtnrvysfnsiiraldnrknkmednakypllniknkfdrvviigggfnaiehkeaiks fiethtntaiifataryareyldvnaphfyclvgneghrlthninpqnlsgicvlppyprpmgtevpey aknvtfelenitfidqykdsvttialqlailltdqdiylvgydgypgnvlsekemaltnenrtifatyt tisgkilksltpsiykeievvsvyqfi
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.04 Rfree 0.2316
    Matthews' coefficent 2.25 Rfactor 0.1965
    Waters 457 Solvent Content 45.37

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch