.
The Open Protein Structure Annotation Network
PDB Keyword
.

3dz1

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of Dihydrodipicolinate Synthase from Rhodopseudomonas palustris at 1.87A resolution. To be Published
    Site NYSGXRC
    PDB Id 3dz1 Target Id NYSGXRC-11102o
    Molecular Characteristics
    Source Rhodopseudomonas palustris
    Alias Ids TPS20426,3.20.20.70, CAE28631.1 Molecular Weight 34597.93 Da.
    Residues 317 Isoelectric Point 6.03
    Sequence mkltpeaagtfaiaptpfhddgkiddvsidrltdfyaevgcegvtvlgilgeapkldaaeaeavatrfi kraksmqvivgvsapgfaamrrlarlsmdagaagvmiapppslrtdeqittyfrqateaigddvpwvlq dypltlsvvmtpkvirqivmdsascvmlkhedwpglekittlrgfqkdgslrplsilcgngglfldfem ergadgamtgycfpdmlvdvvklskagqrdlahnlfdahlpliryehqqgvglsvrkyvlkkrgllsss aqrkpgasltdtareevdyllsrlarvdkradfeprtkaae
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.87 Rfree 0.215
    Matthews' coefficent 2.28 Rfactor 0.190
    Waters 330 Solvent Content 46.00

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch