.
The Open Protein Structure Annotation Network
PDB Keyword
.

3e03

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a putative dehydrogenase from Xanthomonas campestris. To be Published
    Site NYSGXRC
    PDB Id 3e03 Target Id NYSGXRC-11152b
    Molecular Characteristics
    Source Xanthomonas campestris
    Alias Ids TPS20448,NP_638631.1, 3.40.50.720 Molecular Weight 28124.77 Da.
    Residues 271 Isoelectric Point 6.05
    Sequence mtlsgktlfitgasrgiglaialraardganvaiaaksavanpklpgtihsaaaavnaaggqglalkcd ireedqvraavaatvdtfggidilvnnasaiwlrgtldtpmkrfdlmqqvnargsfvcaqaclphllqa pnphiltlapppslnpawwgahtgytlakmgmslvtlglaaefgpqgvainalwprtviatdainmlpg vdaaacrrpeimadaahavltreaagfhgqfliddevlaqagitdlsgyavdpqrallpdlfle
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 3
    Resolution (Å) 1.69 Rfree 0.199
    Matthews' coefficent 2.20 Rfactor 0.161
    Waters 806 Solvent Content 44.05

    Ligand Information
    Ligands
    Metals CA (CALCIUM) x 1

    Jmol

     
    Google Scholar output for 3e03
    1. A New Library of Surface Patches: Design and Applications
    R Gamliel, K Kedem, R Kolodny, C Keasar - 2009 - cs.bgu.ac.il
     
    2. Protein Physics by Advanced Computational Techniques: Conformational Sampling and Folded State Discrimination
    PC Tejada - 2011 - sissa.it
     
    3. SULFONYLUREA-RESPONSIVE REPRESSOR PROTEINS
    M Lassner, LL Looger, KE Mcbride - US Patent , 2011 - freepatentsonline.com
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch