.
The Open Protein Structure Annotation Network
PDB Keyword
.

3e0s

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of an uncharacterized protein from Chlorobium tepidum. To be Published
    Site NYSGXRC
    PDB Id 3e0s Target Id NYSGXRC-10035h
    Molecular Characteristics
    Source Chlorobium tepidum
    Alias Ids TPS20456,Q8KE09, PF05235 Molecular Weight 59408.66 Da.
    Residues 522 Isoelectric Point 6.97
    Sequence msdtqgslffringqmplvqsvgqnlpegwslgkhssrrerlvfydtfeeeafrnglavmhrkgtlsii dlesgaveaetplaqtppsffatdlpegkvrkrllqcstlrafinrcavdrfisswrilnrdnktvatl dheslhpvdktsktvfpqhfsitplkgyhkelspmlmalpesvdayrivsfkerfmtimeaaeplgrgy ssklrlqldahasihenvrrllqfttsimeaneegirkdidseflhdfrvairrsrsilrllngvfdpe ktawmlaglrelgkrtndlrdsdvyllrreeytsllppslrpaldpffsdleadkrlhhrqfcryltgr eysgfmtslkefiaegelpdpetaplaaeptgdvaaktirkalkkvlvhgrrtgsetsdaelhelridc kklrylleffaslfppkataqvlrqmktlqdnlgtfvdltvqmeflqsrletipadrggiseaaaiggl lttlyrkrekvrehfheifsgfdsnetgelfdelltgla
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.09 Rfree 0.272
    Matthews' coefficent 2.54 Rfactor 0.218
    Waters 193 Solvent Content 51.65

    Ligand Information
    Ligands SO4 (SULFATE) x 5
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch