.
The Open Protein Structure Annotation Network
PDB Keyword
.

3e18

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title CRYSTAL STRUCTURE OF NAD-BINDING PROTEIN FROM Listeria innocua. To be Published
    Site NYSGXRC
    PDB Id 3e18 Target Id NYSGXRC-11138b
    Molecular Characteristics
    Source Listeria innocua
    Alias Ids TPS20444,3.40.50.720, CAC97490.1 Molecular Weight 38425.81 Da.
    Residues 349 Isoelectric Point 5.19
    Sequence mkkyqlvivgyggmgsyhvtlasaadnlevhgvfdilaekreaaaqkglkiyesyeavladekvdavli atpndshkelaisaleagkhvvcekpvtmtsedllaimdvakrvnkhfmvhqnrrwdedfliikemfeq ktigemfhlesrvhgangipgdwrhlkahgggmvldwgvhlldqllflvdsnvksvsanlsfalgdevd dgfvtfitfengitaqievgttnfiklprwyvkgtegtgiihdwdlsgeivkptalaktseptpikagq gltktmappseeatntlslpapaklapsfynnfvdvlnntsepivqneevyqvlklieaifeaaetnrtvhsi
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.95 Rfree 0.23656
    Matthews' coefficent 2.54 Rfactor 0.1868
    Waters 418 Solvent Content 51.70

    Ligand Information
    Ligands NAD (NICOTINAMIDE-ADENINE-DINUCLEOTIDE) x 2;GOL (GLYCEROL) x 10
    Metals MG (MAGNESIUM) x 2;CL (CHLORIDE) x 1

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch