.
The Open Protein Structure Annotation Network
PDB Keyword
.

3e2v

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of an uncharacterized amidohydrolase from Saccharomyces cerevisiae. To be Published
    Site NYSGXRC
    PDB Id 3e2v Target Id NYSGXRC-9626a
    Molecular Characteristics
    Source Saccharomyces cerevisiae
    Alias Ids TPS20416,PF01026, 51012703 Molecular Weight 47397.49 Da.
    Residues 418 Isoelectric Point 6.29
    Sequence mwgillkssnkscsrlwkpiltqyysmtstatdsplkyydiglnltdpmfhgiyngkqyhpadyvklle raaqrhvknalvtgssiaesqsaielvssvkdlsplklyhtigvhpccvnefadasqgdkasasidnps mdeayneslyakvisnpsfaqgklkelydlmnqqakphdtsfrsigeigldydrfhysskemqkvffee qlkisclndklssyplflhmrsacddfvqilerfiagftderdtfqlqklgassssgfykfhpdrklvv hpftgsaidlqkllnlspnifigvngcslrteenlavvkqipterllletdapwceikrthasfqylak yqevrdfeypafksvkknkladklnaeelymvkgrnepcnmeqvaivvsevkdvdlatlidttwkttckifge
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.50 Rfree 0.199
    Matthews' coefficent 2.17 Rfactor 0.173
    Waters 704 Solvent Content 43.32

    Ligand Information
    Ligands GOL (GLYCEROL) x 4
    Metals MG (MAGNESIUM) x 3

    Jmol

     
    Google Scholar output for 3e2v
    1. Ligands in PSI structures
    A Kumar, HJ Chiu, HL Axelrod, A Morse - Section F: Structural , 2010 - scripts.iucr.org
     
    2. Calmodulin regulates Ca2+-sensing receptor-mediated Ca2+ signaling and its cell surface expression
    Y Huang, Y Zhou, HC Wong, A Castiblanco - Journal of Biological , 2010 - ASBMB
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch