.
The Open Protein Structure Annotation Network
PDB Keyword
.

3e3v

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of RecX. To be Published
    Site NYSGXRC
    PDB Id 3e3v Target Id NYSGXRC-10123p
    Molecular Characteristics
    Source Lactobacillus salivarius
    Alias Ids TPS20462,Q1WV04, PF02631 Molecular Weight 31188.97 Da.
    Residues 267 Isoelectric Point 6.42
    Sequence vvkkitmiqtqkkvgrfniyinnkyafpvsesilikyrlhkgqeldenlieeikladdiskgynaalny lsyqlrtrkevedklrsldihedyiseiinklidldlindknyaesyvrtmmntsdkgpkviklnlskk giddniaedalilytdklqvekgvtlaeklanryshdsyrnkqnkikqslltkgfsydiidtiiqeldl ifdddtereillekanklwsrydnldikkrkfkiqqalfkqgfsfsnitsaldeiedtni
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.04 Rfree 0.258
    Matthews' coefficent 2.07 Rfactor 0.247
    Waters 50 Solvent Content 40.49

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch