.
The Open Protein Structure Annotation Network
PDB Keyword
.

3e61

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a putative transcriptional repressor of ribose operon from Staphylococcus saprophyticus subsp. saprophyticus. To be Published
    Site NYSGXRC
    PDB Id 3e61 Target Id NYSGXRC-11018w
    Molecular Characteristics
    Source Staphylococcus saprophyticus
    Alias Ids TPS20420,3.40.50.2300, PF00532, Q49XF6_STAS1 Molecular Weight 35890.19 Da.
    Residues 321 Isoelectric Point 6.89
    Sequence matikdvatlagcsvatvsrainnngyvkaktrlhieeaiaelnyqpneaartlykrkskliglllpdm snpfftliargvedvalahgyqvlignsdndikkaqgylatfvshnctgmistafneniientltdhhi pfvfidrinnehngistnhfkggqlqaevvrkgkgknvlivhenllidafhqrvqgikyildqqridyk mleatlldndkkfidlikelsidsiicsndllainvlgivqryhfkvpaeiqiigydnipfsemtypqi ttidqsayhlgeiavsqllglntdnltnnhkqlaltvkhrgstrn
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.00 Rfree 0.259
    Matthews' coefficent 2.18 Rfactor 0.212
    Waters 119 Solvent Content 43.49

    Ligand Information
    Ligands GOL (GLYCEROL) x 2
    Metals

    Jmol

     
    Google Scholar output for 3e61
    1. Molecular probes of the mechanism of cytochrome P450. Oxygen traps a substrate radical intermediate
    HLR Cooper, JT Groves - Archives of Biochemistry and Biophysics, 2011 - Elsevier
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch