.
The Open Protein Structure Annotation Network
PDB Keyword
.

3e7p

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title CRYSTAL STRUCTURE OF of putative methyltransferase from Bacteroides vulgatus ATCC 8482. To be Published
    Site NYSGXRC
    PDB Id 3e7p Target Id NYSGXRC-11126g
    Molecular Characteristics
    Source Bacteroides vulgatus
    Alias Ids TPS20434,YP_001300506.1, 3.40.50.150 Molecular Weight 29800.33 Da.
    Residues 262 Isoelectric Point 5.91
    Sequence mnndnntilgfdvnlicdfflnterqgpgspevtlkalsfidnltnksliadlgcgtggqtmilaqhvp gkitgidffpgfierfnknaeklnlqnrvkgivgsmddlsfekdsldliwsegaiynigferglkewrn ylkpggylavsesvwftdqrpaeihdfwmsayteidtvpnkvaqiqkagyipvatfilpencwiehyfa pqakaeeifrrkhagsriveelitsnhheaelyskykayygyaffickkgfslrr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.90 Rfree 0.217
    Matthews' coefficent 3.11 Rfactor 0.184
    Waters 193 Solvent Content 60.47

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3e7p
    1. Structural characterization of BVU_3255, a methyltransferase from human intestine antibiotic resistant pathogen Bacteroides vulgatus
    V Kumar, J Sivaraman - Journal of structural biology, 2011 - Elsevier
     
    2. Purification, crystallization and diffraction studies of the methyltransferases BT_2972 and BVU_3255 from antibiotic-resistant pathogens of the genus Bacteroides from
    V Kumar, N Mallika, J Sivaraman - Acta Crystallographica Section F: , 2011 - scripts.iucr.org
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch