.
The Open Protein Structure Annotation Network
PDB Keyword
.

3e82

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a putative oxidoreductase from Klebsiella pneumoniae. To be Published
    Site NYSGXRC
    PDB Id 3e82 Target Id NYSGXRC-11136f
    Molecular Characteristics
    Source Klebsiella pneumoniae
    Alias Ids TPS20442,3.40.50.720, ABR76803.1 Molecular Weight 39970.27 Da.
    Residues 364 Isoelectric Point 5.61
    Sequence lltlnnvenlmsnntinialigygfvgktfhaplirsvpglnlafvasrdeekvkrdlpdvtviaspea avqhpdvdlvviaspnathaplarlalnagkhvvvdkpftldmqearelialaeekqrllsvfhnrrwd sdylgirqvieqgtlgavkhfeshfdrfrpevrvrwreqnvpgsglwfdlgphlidqalqlfglpqsvq gniatlrdgaeindwahvvlnypahkvilhcsmlvaggssrftvhgdkgsvikaradqqesqllagvvp gsadwgqdddplviydaslqahaqatpqgdqrqyymlirdalkgqianpvppvealavmavleaavrsa esgmvqtldlsdderntlr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.04 Rfree 0.232
    Matthews' coefficent 2.72 Rfactor 0.209
    Waters 684 Solvent Content 54.85

    Ligand Information
    Ligands
    Metals CL (CHLORIDE) x 4

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch