.
The Open Protein Structure Annotation Network
PDB Keyword
.

3e96

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of dihydrodipicolinate synthase from bacillus clausii. To be Published
    Site NYSGXRC
    PDB Id 3e96 Target Id NYSGXRC-9375c
    Molecular Characteristics
    Source Bacillus clausii
    Alias Ids TPS20410,PF00701, 56964779 Molecular Weight 33968.05 Da.
    Residues 306 Isoelectric Point 5.36
    Sequence vankplakaletisgipitpfrksdgsidwhhyketvdrivdngidvivpcgntsefyalsleeakeev rrtveyvhgralvvagigyatstaielgnaakaagadavmihmpihpyvtaggvyayfrdiiealdfps lvyfkdpeisdrvlvdlaplqnlvgvkyaindlprfakvvrsipeehqiawicgtaekwapffwhagak gftsglvnllpqkavemlealrnndndavwriwedivpfedlrgkynqgnnvvvikeamemlrqnagvt rapvnelsnedkqlvtellsswkllqptkg
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.80 Rfree 0.213
    Matthews' coefficent 2.64 Rfactor 0.193
    Waters 453 Solvent Content 53.42

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3e96
    1. Biochemical studies and crystal structure determination of dihydrodipicolinate synthase from Pseudomonas aeruginosa
    N Kaur, A Gautam, S Kumar, A Singh, N Singh - International Journal of , 2011 - Elsevier
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch