The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of an oxidoreductase from Enterococcus faecalis. To be Published
    Site NYSGXRC
    PDB Id 3e9m Target Id NYSGXRC-11133d
    Molecular Characteristics
    Source Enterococcus faecalis
    Alias Ids TPS20438,, AAO80639.1 Molecular Weight 35746.88 Da.
    Residues 321 Isoelectric Point 5.14
    Sequence mdkirygimstaqivprfvaglresaqaevrgiasrrlenaqkmakelaipvaygsyeelckdetidii yiptynqghysaaklalsqgkpvllekpftlnaaeaeelfaiaqeqgvflmeaqksvflpitqkvkati qegglgeilwvqsvtaypnvdhipwfysreagggalhgsgsyplqylqyvlgkeiqevtgtatyqqgat dsqcnlalkfaegtlgnifinvglkipsemticgtkgqivipnfwktdcayytdaqgntvkwseqftse ftyeinhvnqclqdkkltspvmtkeltiatvkivesfyqewfdne
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.70 Rfree 0.294
    Matthews' coefficent 2.26 Rfactor 0.233
    Waters Solvent Content 45.69

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch