The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of ABC transporter, substrate binding protein Aeropyrum pernix. To be Published
    Site NYSGXRC
    PDB Id 3eaf Target Id NYSGXRC-11229a
    Molecular Characteristics
    Source Aeropyrum pernix
    Alias Ids TPS20454,, PF01094, NP_147857.2 Molecular Weight 46362.88 Da.
    Residues 427 Isoelectric Point 4.63
    Sequence vaqnrtliyaaaaivaliviaaaafflmggeeaageggeaektitinvgllvdetgptsdvgkgyslga elafkyfnekgiytkdgvrvninyikrdyaynpttaeeyyrefrdrygviaiigwgtadteklsdqvdt dkityisasysakllvkpfnfypapdystqacsglaflasefgqgklalaydskvaysrspigaikkaa pslglqvvgdydlplrateadaeriaremlaadpdyvwcgntisscsllgramakvgldaflltnvwgf derspqligeggygkvfgispfiypmfgqdvegiqtifeaarmngvsedqinlrvvqgfvnvwllikai esvtsqdlqerggealkealeantfdlggitadtidyepgfhlayrkvfiiklgengelqlmgkfeaps qvdcarytieegg
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.00 Rfree 0.20651
    Matthews' coefficent 2.08 Rfactor 0.16484
    Waters 218 Solvent Content 40.86

    Ligand Information
    Ligands GOL (GLYCEROL) x 1
    Metals MG (MAGNESIUM) x 1



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch