.
The Open Protein Structure Annotation Network
PDB Keyword
.

3eb2

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of Dihydrodipicolinate Synthase from Rhodopseudomonas palustris at 2.0A resolution. To be Published
    Site NYSGXRC
    PDB Id 3eb2 Target Id NYSGXRC-11102n
    Molecular Characteristics
    Source Rhodopseudomonas palustris
    Alias Ids TPS20424,3.20.20.70, CAE27012.1 Molecular Weight 31460.58 Da.
    Residues 292 Isoelectric Point 5.87
    Sequence mmadfhgvfpylvspvdaegrvradvmgrlcddliqagvhgltplgstgefaylgtaqreavvratiea aqrrvpvvagvastsvadavaqaklyeklgadgilaileayfplkdaqiesyfraiadaveipvviytn pqfqrsdltldviarlaehpriryikdastntgrllsiinrcgdalqvfsasahipaavmliggvgwma gpaciaprqsvalyelckaqrwdealmlqrklwrvneafakfnlaacikaglalqgydvgdpippqaal taeerkavekvlaeia
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.04 Rfree 0.248
    Matthews' coefficent 2.50 Rfactor 0.212
    Waters 605 Solvent Content 50.85

    Ligand Information
    Ligands PGE (TRIETHYLENE) x 2
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch