.
The Open Protein Structure Annotation Network
PDB Keyword
.

3ebv

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of putative Chitinase A from Streptomyces coelicolor. To be Published
    Site NYSGXRC
    PDB Id 3ebv Target Id NYSGXRC-11098e
    Molecular Characteristics
    Source Streptomyces coelicolor
    Alias Ids TPS24522,CAB92596.1, 3.20.20.80 Molecular Weight 58066.89 Da.
    Residues 571 Isoelectric Point 5.98
    Sequence vdpvrrrsrgrrlgsltgavtaalalaftavgpasaadvnnaknagfesglsnwacsansgttvaspah agsaalkatpagqdnarcsqsvavkpnstytlsawvqggysylgvtgtgttdvstwtpdstawkqlktt fstgssttsvsvythgwygqaayyvddlsvfgpdggggdggnpdptvpsapaglsvsgttpnsaslswn tvsgatgynvyrdgtkvtavtgtsatvtglaastsysfqvtatnaagesvksaavtarttapddggngg dlpkhavtgywqnfnngatvqkisdvpsaydiiavafadatttpgavtfnldsaglggytvdqfkadvr akqaagkkviisvggekgtvsvnssasatnfansvysvmreygfdgvdidlenglnptymtqalralsa kagpdmiltmapqtidmqstqggyfqtalnvkdiltvvnmqyynsgtmlgcdgkvyaqgtvdfltalac iqlegglapsqvglglpastraagggyvspsvvnaaldcltkatncgsfkpsktypdlrgamtwstnwd atagnawsnsvgahvhalp
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.50 Rfree 0.169
    Matthews' coefficent 3.49 Rfactor 0.156
    Waters 299 Solvent Content 64.78

    Ligand Information
    Ligands SO4 (SULFATE) x 1
    Metals

    Jmol

     
    Google Scholar output for 3ebv
    1. comparative Molecular evolution of Trichoderma chitinases in Response to Mycoparasitic Interactions
    K Ihrmark, N Asmail, W Ubhayasekera - Evolutionary , 2010 - ncbi.nlm.nih.gov
     
    2. Hallmarks of processivity in glycoside hydrolases from crystallographic and computational studies of the Serratia marcescens chitinases
    CM Payne, J Baban, SJ Horn, PH Backe - Journal of Biological , 2012 - ASBMB
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch