.
The Open Protein Structure Annotation Network
PDB Keyword
.

3ed4

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of Arylsulfatase from Escherichia Coli. To be Published
    Site NYSGXRC
    PDB Id 3ed4 Target Id NYSGXRC-13574a
    Molecular Characteristics
    Source Escherichia coli
    Alias Ids TPS20408,PF00884, AAN78522.1 Molecular Weight 57187.33 Da.
    Residues 509 Isoelectric Point 6.64
    Sequence lvmisnfyqgiimqktlmasliglavctgnafspalaaeakqpnlviimaddlgygdlatyghqivktp nidrlaqegvkftdyyapaplsspsraglltgrmpfrtgirswipsgkdvalgrneltianllkaqgyd tammgklhlnaggdrtdqpqaqdmgfdyslantagfvtdatldnakerprygmvyptgwlrngqptpra dkmsgeyvssevvnwldnkkdskpfflyvaftevhsplaspkkyldmysqymsayqkqhpdlfygdwad kpwrgvgeyyanisyldaqvgkvldkikamgeedntiviftsdngpvtrearkvyelnlagetdglrgr kdnlweggirvpaiikygkhlpqgmvsdtpvygldwmptlakmmnfklptdrtfdgeslvpvleqkalk rekplifgidmpfqddptdewairdgdwkmiidrnnkpkylynlksdryetlnligkkpdiekqmygkf lkyktdidndslmkargdkpeavtwg
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 1.70 Rfree 0.24220
    Matthews' coefficent 2.18 Rfactor 0.19627
    Waters 1523 Solvent Content 43.56

    Ligand Information
    Ligands GOL (GLYCEROL) x 3;SO4 (SULFATE) x 4;UNL (UNKNOWN) x 6
    Metals NA (SODIUM) x 6

    Jmol

     
    Google Scholar output for 3ed4
    1. Distinct and essential morphogenic functions for wall-and lipo-teichoic acids in Bacillus subtilis
    K Schirner, J Marles-Wright, RJ Lewis, J Errington - The EMBO journal, 2009 - nature.com
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch