.
The Open Protein Structure Annotation Network
PDB Keyword
.

3edm

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a short chain dehydrogenase from Agrobacterium tumefaciens. To be Published
    Site NYSGXRC
    PDB Id 3edm Target Id NYSGXRC-10049o
    Molecular Characteristics
    Source Agrobacterium tumefaciens
    Alias Ids TPS20418,17936737, PF00106 Molecular Weight 25665.77 Da.
    Residues 249 Isoelectric Point 6.91
    Sequence mqrftnrtivvagagrdigracairfaqeganvvltyngaaegaatavaeieklgrsalaikadltnaa eveaaisaaadkfgeihglvhvaggliarktiaemdeafwhqvldvnltslfltaktalpkmakggaiv tfssqagrdgggpgalayatskgavmtftrglakevgpkirvnavcpgmisttfhdtftkpevrervag atslkregssedvaglvaflasddaayvtgacydinggvlfs
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.30 Rfree 0.259
    Matthews' coefficent 2.37 Rfactor 0.195
    Waters 189 Solvent Content 48.14

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch