.
The Open Protein Structure Annotation Network
PDB Keyword
.

3eeg

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a 2-isopropylmalate synthase from Cytophaga hutchinsonii. To be Published
    Site NYSGXRC
    PDB Id 3eeg Target Id NYSGXRC-11106d
    Molecular Characteristics
    Source Cytophaga hutchinsonii
    Alias Ids TPS24524,YP_680317.1, 3.20.20.70 Molecular Weight 42310.05 Da.
    Residues 386 Isoelectric Point 6.03
    Sequence mgkrifvfdttlrdgeqvpgcqlnteekiivakaldelgvdvieagfpvsspgdfnsvveitkavtrpt icaltrakeadiniagealrfakrsrihtgigssdihiehklrstrenilemavaavkqakkvvhevef fcedagradqaflarmveavieagadvvnipdttgymlpwqygerikylmdnvsnidkailsahchndl glatanslaalqngarqvectingigeragntaleevvmamechketlgletginhkklvpishlvstl mrmqvqsnkaivgrnafahssgihqdgflkhretyeiidpaavgadsssiiltarsgraalnhrlatig ymlskdqldqaytqfldmadhlrkvedenlhelmrgkvyak
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.78 Rfree 0.298
    Matthews' coefficent 2.18 Rfactor 0.245
    Waters 56 Solvent Content 43.53

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3eeg
    1. Structural and Functional Characterization of _-Isopropylmalate Synthase and Citramalate Synthase, members of the LeuA Dimer Superfamily
    PA Frantom - Archives of Biochemistry and Biophysics, 2011 - Elsevier
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch