.
The Open Protein Structure Annotation Network
PDB Keyword
.

3eeq

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a putative cobalamin biosynthesis protein G homolog from Sulfolobus solfataricus. To be Published
    Site NYSGXRC
    PDB Id 3eeq Target Id NYSGXRC-10037q
    Molecular Characteristics
    Source Sulfolobus solfataricus
    Alias Ids TPS20460,Q97WD0, PF01890 Molecular Weight 37662.82 Da.
    Residues 337 Isoelectric Point 6.79
    Sequence mesggrltmienlwrgiciisasedafsagetikeklksfeipvvhyrykdaeietiwkcydaivfvma legatrivckyaksktedpaivciddkinyvipllgghwgandiarelsvilnstpiittaaeikgkls ierianiliakiinpenivkinaallrdesicidgidvnvnfpenikvnseecsyiislrgdkeykdki vvwlkplkisigigskkdvkmeeirdgiykvlerlnlkrerigiiasireevkkiadefnvrfrlvnee einnfmnpcltppsktlievglkgvaeisaliaggrnsklilrkiaisrnstiavatyege
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.30 Rfree 0.284
    Matthews' coefficent 2.29 Rfactor 0.237
    Waters 34 Solvent Content 46.18

    Ligand Information
    Ligands SO4 (SULFATE) x 6
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch