.
The Open Protein Structure Annotation Network
PDB Keyword
.

3eey

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of Rrna-Methylase from Clostridium Thermocellum. To be Published
    Site NYSGXRC
    PDB Id 3eey Target Id NYSGXRC-11114c
    Molecular Characteristics
    Source Clostridium thermocellum
    Alias Ids TPS20430,ABN51931.1, 3.40.50.150 Molecular Weight 20726.75 Da.
    Residues 188 Isoelectric Point 5.38
    Sequence mqtiknslgqshdyikmfvkegdtvvdatcgngndtaflaslvgengrvfgfdiqdkaianttkkltdl nlidrvtlikdghqnmdkyidcpvkavmfnlgylpsgdhsistrpettiqalskamellvtggiitvvi yyggdtgfeekekvleflkgvdqkkfivqrtdfinqancppilvciekis
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.20 Rfree 0.27843
    Matthews' coefficent 2.53 Rfactor 0.24361
    Waters 361 Solvent Content 51.41

    Ligand Information
    Ligands SAM (S-ADENOSYLMETHIONINE) x 9;SO4 (SULFATE) x 5;GOL (GLYCEROL) x 4
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch