.
The Open Protein Structure Annotation Network
PDB Keyword
.

3egc

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a putative ribose operon repressor from Burkholderia thailandensis.
    Site NYSGXRC
    PDB Id 3egc Target Id NYSGXRC-11021v
    Molecular Characteristics
    Source Burkholderia thailandensis
    Alias Ids TPS21061,Q2T0D1_BURTA, 3.40.50.2300, PF00532 Molecular Weight 37594.83 Da.
    Residues 343 Isoelectric Point 7.85
    Sequence mgrkshshtvtlkdvareaevsyqtvsraingydeisaetrekvldvcrrlgyrpnrlagslrskrsnvv glivsdienvffaevasgvesearhkgysvllantaedivrereavgqfferrvdglilapsegehdyl rtelpktfpivavnrelripgcgavlsenvrgartaveyliarghtrigaivgsaglmtsrerlkgfra amsaaglpvrqewiaaggvradngrdgaikvltgadrptalltsshritegamqalnvlglrygpdvei vsfdnlpwmafldpplpvveqptrrigqeamrmlihmiegtgnatemrlqtrfvthvgqdlsveae
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 6
    Resolution (Å) 2.35 Rfree 0.299
    Matthews' coefficent 2.22 Rfactor 0.257
    Waters 249 Solvent Content 44.64

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch