.
The Open Protein Structure Annotation Network
PDB Keyword
.

3ego

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of Probable 2-dehydropantoate 2-reductase panE from Bacillus Subtilis. To be published
    Site NYSGXRC
    PDB Id 3ego Target Id NYSGXRC-11137f
    Molecular Characteristics
    Source Bacillus subtilis
    Alias Ids TPS21072,3.40.50.720, CAB13384.1 Molecular Weight 33285.28 Da.
    Residues 298 Isoelectric Point 5.88
    Sequence mkigiigggsvgllcayylslyhdvtvvtrrqeqaaaiqsegirlykggeefradcsadtsinsdfdll vvtvkqhqlqsvfsslerigktnilflqngmghihdlkdwhvghsiyvgivehgavrksdtavdhtglg aikwsafddaepdrlnilfqhnhsdfpiyyetdwyrlltgklivnacinpltallqvkngellttpayl afmklvfqeacrilkleneekawervqavcgqtkenrssmlvdviggrqteadaiigyllkeaslqgld avhleflygsikalerntnkvf
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.90 Rfree 0.260
    Matthews' coefficent 2.12 Rfactor 0.204
    Waters 202 Solvent Content 41.86

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3ego
    1. Detecting subtle functional differences in ketopantoate reductase and related enzymes using a rule-based approach with sequence-structure homology recognition
    S Mondal, C Nagao, K Mizuguchi - Protein Engineering Design , 2010 - Oxford Univ Press
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch