.
The Open Protein Structure Annotation Network
PDB Keyword
.

3ehe

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of galE-1 from Archaeoglobus fulgidus. To be Published
    Site NYSGXRC
    PDB Id 3ehe Target Id NYSGXRC-11140g
    Molecular Characteristics
    Source Archaeoglobus fulgidus
    Alias Ids TPS21074,3.40.50.720, NP_069197.1 Molecular Weight 34256.12 Da.
    Residues 305 Isoelectric Point 5.05
    Sequence mivvtggagfigshvvdklsesneivvidnlssgneefvneaarlvkadlaaddikdylkgaeevwhia anpdvrigaenpdeiyrnnvlatyrlleamrkagvsrivftststvygeakviptpedypthpislyga sklacealiesychtfdmqawiyrfanvigrrsthgviydfimklkrnpeeleilgngeqnksyiyisd cvdamlfglrgdervnifnigsedqikvkriaeivceelglsprfrftggdrgwkgdvpvmllsieklk rlgwkprynseeavrmavrdlvedldeqn
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.87 Rfree 0.287
    Matthews' coefficent 2.37 Rfactor 0.253
    Waters 195 Solvent Content 48.12

    Ligand Information
    Ligands NAD (NICOTINAMIDE-ADENINE-DINUCLEOTIDE) x 2
    Metals

    Jmol

     
    Google Scholar output for 3ehe
    1. The crystal structure of ADP-L- glycero-D- manno-heptose-6-epimerase (HP0859) from Helicobacter pylori
    MM Shaik, G Zanotti, L Cendron - et Biophysica Acta (BBA)-Proteins & , 2011 - Elsevier
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch