.
The Open Protein Structure Annotation Network
PDB Keyword
.

3emu

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a leucine rich repeat and phosphatase domain containing protein from Entamoeba histolytica. To be Published
    Site NYSGXRC
    PDB Id 3emu Target Id NYSGXRC-9029a
    Molecular Characteristics
    Source Entamoeba histolytica
    Alias Ids TPS21078,PF00782 Molecular Weight 52217.87 Da.
    Residues 461 Isoelectric Point 5.70
    Sequence mtinlndflhdgfldisllhisqfpltsqycienevtglnassnnfilirdlreyvmlkeidlsfnkln tipfvppslkklnirnnelyqcnsfstltelnishnniaaippmnhllnldcsfnrifsfppilsltsl niisnqltsidisheslielkcsmnkltsvilelnhltfldisinplqhlditkcsslntlylnncnse pflsklplslkelslqscglnkfpidltllsnltslnlssndllvlppiyttlqylktidismnllecf pvfhpslellkiggnyyletihitppyqvltfptlsptqiiqyihlgsflnahnvdyihnnnissillv gievpslfkdqcdilrldivseeghqlydsipnaikfiirsiqrkegvliicgtgvnkapaiviaflmy yqrlsfinafnkvqglyplidiesgfilqlklfekklekmnsnciiv
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.30 Rfree 0.236
    Matthews' coefficent 4.67 Rfactor 0.230
    Waters 33 Solvent Content 73.64

    Ligand Information
    Ligands SO4 (SULFATE) x 1
    Metals

    Jmol

     
    Google Scholar output for 3emu
    1. Complex network spectral moments for ATCUN motif DNA cleavage: first predictive study on proteins of human pathogen parasites
    CR Munteanu, JM Va_zquez, J Dorado - Journal of proteome , 2009 - ACS Publications
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch