.
The Open Protein Structure Annotation Network
PDB Keyword
.

3emx

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of thioredoxin from Aeropyrum pernix. To be Published
    Site NYSGXRC
    PDB Id 3emx Target Id NYSGXRC-11213f
    Molecular Characteristics
    Source Aeropyrum pernix
    Alias Ids TPS21076,NP_147384.1, 3.40.30.10, PF00085 Molecular Weight 37049.04 Da.
    Residues 349 Isoelectric Point 4.57
    Sequence vmvastfvvvfqgfgltapqgggsspsgggeeggleepqglfptvsytlplaggdrlvyeststsasgt nvatnavsivepgwpessvevqlleagdpvvtstpekgvltttllalpkeylgmqeivipvyippgrsg lcmrltleageaggytyrgyanvgdytiavkavyrgdgileafeagivggglsirytqslveasvsgsd tmvsvewectadgfssnlsyvkeglavledgrliyitpeefrqllqgdailavysktcphchrdwpqli qaskevdvpivmfiwgsligerelsaarlemnkagvegtptlvfykegrivdklvgatpwslkvekareiygg
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.25 Rfree 0.254
    Matthews' coefficent 1.87 Rfactor 0.195
    Waters 48 Solvent Content 34.17

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3emx
    1. Remote thioredoxin recognition using evolutionary conservation and structural dynamics
    GW Tang, RB Altman - Structure, 2011 - Elsevier
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch