.
The Open Protein Structure Annotation Network
PDB Keyword
.

3eoi

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of an uncharacterized protein. to be published
    Site NYSGXRC
    PDB Id 3eoi Target Id NYSGXRC-10170a
    Molecular Characteristics
    Source Escherichia coli
    Alias Ids TPS27182,Q68JC9, PF07419 Molecular Weight 16287.96 Da.
    Residues 145 Isoelectric Point 9.30
    Sequence mgwvtgfimvimaignfwfhshlsrtvhhqqtaeitqqaadfirymnaindylyqhperraaggqltsa qlglpatknvshlisqqrvfvwakekpglmgalleqsgdsallarvengrlldthgrrisitlpavipd qviiwmn
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.52 Rfree 0.23688
    Matthews' coefficent 2.16 Rfactor 0.18961
    Waters 357 Solvent Content 43.06

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3eoi
    1. Towards structure-based protein drug design
    C Zhang, L Lai - Biochemical Society Transactions, 2011 - www-06.all-portland.net
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch