.
The Open Protein Structure Annotation Network
PDB Keyword
.

3eqz

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a response regulator from Colwellia psychrerythraea. To be Published
    Site NYSGXRC
    PDB Id 3eqz Target Id NYSGXRC-11021s
    Molecular Characteristics
    Source Colwellia psychrerythraea
    Alias Ids TPS24518,Q483U6_COLP3, 3.40.50.2300, PF00072 Molecular Weight 45204.69 Da.
    Residues 397 Isoelectric Point 4.98
    Sequence mmnrvfivdddtltcnllktivepifgnveafqhprafltlslnkqdiiildlmmpdmdgievirhlae hkspaslilisgydsgvlhsaetlalscglnvintftkpintevltcfltslsnrqaqrelvsfnndka nqgkfdfipteqdlreaidkkqlilyyqpqinmkteclhgaevlvrwlhpefgliypdkfialaeqtgl ieqlseevihlaikqsvhwqklnratrlsinisaqnitslklpeqlrmlvkkyeidpsmivleltesal mdsevtsldiftrfrlkgfqlsiddfgtgysslsqlhkipftelkidqsfvtnmkqekesmaivetcim lahklnmeavaegiedketwdllsaegcdiaqgyyiarpmpadqfdkwqfne
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.15 Rfree 0.250
    Matthews' coefficent 2.57 Rfactor 0.213
    Waters 77 Solvent Content 52.06

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3eqz
    1. Expression, purification and preliminary crystallographic analysis of Pseudomonas aeruginosa RocR protein
    M Kotaka, S Dutta, HC Lee, MJM Lim - Section F: Structural , 2009 - scripts.iucr.org
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch