.
The Open Protein Structure Annotation Network
PDB Keyword
.

3esm

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of an uncharacterized protein from Nocardia farcinica reveals an immunoglobulin-like fold. To be Published
    Site NYSGXRC
    PDB Id 3esm Target Id NYSGXRC-10205d
    Molecular Characteristics
    Source Nocardia farcinica
    Alias Ids TPS24546,Q5Z3N8, PF07987 Molecular Weight 22198.34 Da.
    Residues 219 Isoelectric Point 5.12
    Sequence mrsslsracgtavaavgvvlltggtaaahvtadapgaaqggysvvtfrvptesetaattaltvtlpnvr sarteplpgwtarvdrndkseavsvtwtadpgnpgvqpgqfqrfvvsigplpsaetvsfpaeqtysdgr vvawnqppaadgsepehpaptltlatapgdtaadghhvgteaahaddasdetarwlggiglalglfava lglgtvirgrra
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.65 Rfree 0.262
    Matthews' coefficent 2.58 Rfactor 0.230
    Waters 111 Solvent Content 52.26

    Ligand Information
    Ligands SO4 (SULFATE) x 2;DMS (DIMETHYL) x 1
    Metals

    Jmol

     
    Google Scholar output for 3esm
    1. Ligands in PSI structures
    A Kumar, HJ Chiu, HL Axelrod, A Morse - Section F: Structural , 2010 - scripts.iucr.org
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch