.
The Open Protein Structure Annotation Network
PDB Keyword
.

3etk

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of an uncharacterized metal-dependent hydrolase from Pyrococcus furiosus. To be Published
    Site NYSGXRC
    PDB Id 3etk Target Id NYSGXRC-9564b
    Molecular Characteristics
    Source Pyrococcus furiosus
    Alias Ids TPS24514,18977218, PF07969 Molecular Weight 56881.28 Da.
    Residues 503 Isoelectric Point 5.75
    Sequence maslpisnfftfnhqstlftkvknfmgvkhigdcmkalingtiytsfspvkkvsglvisnervlyagds stalriaelaggeiidlkgkfvmpaffdshlhldelgmslemvdlrgvksmeelvervkkgrgriifgf gwdqdelgrwptredldvidrpvflyrrcfhvavmnskmidllnlkpskdfdestgivreraleesrki inekiltvkdykhyiesaqehllslgvhsvgfmsvgekalkalfeleregrlkmnvfaylspelldkle elnlgkfegrrlriwgvklfvdgslgartallsepytdnpttsgelvmnkdeivevierakplgldvav haigdkavdvaldafeeaefsgriehaslvrddqlerikelkvrisaqphfivsdwwivnrvgeerakw ayrlktlssitklgfstdspiepadpwvsidaavnryvvdpgervsreealhlythgsaqvtlaedlgk lergfraeyiildrdplken
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.10 Rfree 0.280
    Matthews' coefficent 2.41 Rfactor 0.220
    Waters 185 Solvent Content 48.94

    Ligand Information
    Ligands
    Metals MG (MAGNESIUM) x 2

    Jmol

     
    Google Scholar output for 3etk
    1. Ligands in PSI structures
    A Kumar, HJ Chiu, HL Axelrod, A Morse - Section F: Structural , 2010 - scripts.iucr.org
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch