.
The Open Protein Structure Annotation Network
PDB Keyword
.

3euw

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of a Myo-inositol dehydrogenase from Corynebacterium glutamicum ATCC 13032. To be Published
    Site NYSGXRC
    PDB Id 3euw Target Id NYSGXRC-11149o
    Molecular Characteristics
    Source Corynebacterium glutamicum
    Alias Ids TPS24532,3.40.50.720, NP_602254.1 Molecular Weight 36222.78 Da.
    Residues 335 Isoelectric Point 4.77
    Sequence mtlrialfgagrighvhaaniaanpdlelvviadpfiegaqrlaeangaeavaspdevfarddidgivi gsptsthvdlitravergipalcekpidldiemvrackekigdgaskvmlgfnrrfdpsfaainarvan qeignleqlviisrdpapapkdyiagsggifrdmtihdldmarffvpnivevtatganvfsqeiaefnd ydqvivtlrgskgelinivnsrhcsygydqrleafgskgmlaadnirpttvrkhnaesteqadpifnff lerydaaykaelatfaqgirdgqgfspnfedgvialelanaclesaqtgrtvtlnpanv
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.30 Rfree 0.258
    Matthews' coefficent 3.21 Rfactor 0.223
    Waters 629 Solvent Content 61.66

    Ligand Information
    Ligands
    Metals NA (SODIUM) x 2

    Jmol

     
    Google Scholar output for 3euw
    1. Structural investigation of myo-inositol dehydrogenase from Bacillus subtilis: implications for catalytic mechanism and inositol dehydrogenase subfamily classification
    K van Straaten, H Zheng, D Palmer, D Sanders - Biochem. J, 2010 - biochemj.org
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch