The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title CRYSTAL STRUCTURE OF putative Gfo/Idh/MocA family oxidoreductase from Streptococcus agalactiae 2603V/r. To be Published
    Site NYSGXRC
    PDB Id 3evn Target Id NYSGXRC-11129i
    Molecular Characteristics
    Source Streptococcus agalactiae
    Alias Ids TPS24530,AAM99349.1, Molecular Weight 35517.03 Da.
    Residues 319 Isoelectric Point 6.41
    Sequence mskvrygvvstakvaprfiegvrlagngevvavssrtlesaqafankyhlpkaydkledmladesidvi yvatinqdhykvakaallagkhvlvekpftltydqanelfalaescnlflmeaqksvfipmtqvikkll asgeigevisissttaypnidhvtwfrelelgggtvhfmapyalsylqylfdatithasgtatfpkgqs dsqsklllqlsngvlvdiflttrlnlphemiiygtegrliiphfwktthaklvrndtsartiqvdmvsd fekeayhvsqmilegqrvshimtpqltlsgvkiiedlyrswgk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.00 Rfree 0.285
    Matthews' coefficent 2.43 Rfactor 0.205
    Waters 194 Solvent Content 49.29

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch