.
The Open Protein Structure Annotation Network
PDB Keyword
.

3ewm

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of an uncharacterized sugar kinase PH1459 from pyrococcus horikoshii. To be Published
    Site NYSGXRC
    PDB Id 3ewm Target Id NYSGXRC-11207g
    Related PDB Ids 3ih0 3gbu 
    Molecular Characteristics
    Source Pyrococcus horikoshii
    Alias Ids TPS24544,PF00294, NP_143326.1, 3.40.1190.20 Molecular Weight 33984.67 Da.
    Residues 310 Isoelectric Point 5.40
    Sequence mnlvfgmiasigellidlisveegdlkdvrlfekhpggapanvavgvsrlgvkssliskvgndpfgeyl ieelskenvdtrgivkdekkhtgivfvqlkgaspsfllyddvayfnmtlndinwdiveeakivnfgsvi larnpsretvmkvikkikgssliafdvnlrldlwrgqeeemikvleesikladivkaseeevlylenqg vevkgsmltaitlgpkgcrliknetvvdvpsynvnpldttgagdafmaallvgilklkgldllklgkfa nlvaalstqkrgawstprkdellkykearevlap
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.90 Rfree 0.23906
    Matthews' coefficent 2.07 Rfactor 0.18969
    Waters 441 Solvent Content 40.50

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3ewm
    1. Crystal structure of a fructokinase homolog from Halothermothrix orenii
    TK Chua, J Seetharaman, JM Kasprzak, C Ng - Journal of structural , 2010 - Elsevier
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch