.
The Open Protein Structure Annotation Network
PDB Keyword
.

3exq

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a NUDIX family hydrolase from Lactobacillus brevis.
    Site NYSGXRC
    PDB Id 3exq Target Id NYSGXRC-11180k
    Molecular Characteristics
    Source Lactobacillus brevis
    Alias Ids TPS24542,3.90.79.10, PF00293, YP_795016.1 Molecular Weight 16800.04 Da.
    Residues 153 Isoelectric Point 4.92
    Sequence matrtqpvelvtmvmvtdpetqrvlvedkvnvpwkaghsfpgghvevgepcataairevfeetglrlsgv tfcgtcewfdddrqhrklgllyrasnftgtlkasaegqlswlpitaltrensaaslpeflqvftgtast lvsdswngnlridd
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.00 Rfree 0.250
    Matthews' coefficent 2.76 Rfactor 0.218
    Waters 143 Solvent Content 55.48

    Ligand Information
    Ligands SO4 (SULFATE) x 2
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch