.
The Open Protein Structure Annotation Network
PDB Keyword
.

3eyp

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of putative alpha-L-fucosidase from Bacteroides thetaiotaomicron. To be Published
    Site NYSGXRC
    PDB Id 3eyp Target Id NYSGXRC-11092k
    Molecular Characteristics
    Source Bacteroides thetaiotaomicron
    Alias Ids TPS24520,3.20.20.80, AAO77299.1 Molecular Weight 54622.17 Da.
    Residues 484 Isoelectric Point 6.05
    Sequence mnikvlvasavaafsslpviaqqapapcglvpsarqlewynremiaffhfgintfeeyvnegdgkasta ifnptaldcrqwmqtlkaagipaailtakhadgfclwpskytdysvknaawkngkgdvvrefvdaceey glkagiylgphdrhehlsplytterykeyyahqlgelmsdygkiwetwwdgagadelttpvyrhwykiv rekqpdcvifgtknsypfadvrwmgneageagdpcwattdsvairdeaqyykglnegmldgdayipaet dvsirpswfyhaeedsrvksvrelwdiyctsvgrnsvlllnfppdrrglihstdslhaallkqgidetf stnllrgakvkatnvrgakyspekmldnekntyfagkdgevkadiiftlpktiefdclmieevielghr ttkwsveytvdgknwitipeatdkqaighkwivrlapvkakqvrlriqdgkacpaihtfgvykqspvfkl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.90 Rfree 0.252
    Matthews' coefficent 2.80 Rfactor 0.208
    Waters 638 Solvent Content 56.03

    Ligand Information
    Ligands GOL (GLYCEROL) x 8
    Metals

    Jmol

     
    Google Scholar output for 3eyp
    1. Analysis of the Reaction Coordinate of _-l-Fucosidases: A Combined Structural and Quantum Mechanical Approach
    AL van Bueren, A Arde_vol, J Fayers-Kerr, B Luo - J. Am. Chem. , 2010 - ACS Publications
     
    2. Bifidobacterium longum subsp. infantis ATCC 15697 _-Fucosidases Are Active on Fucosylated Human Milk Oligosaccharides
    DA Sela, D Garrido, L Lerno, S Wu, K Tan - Applied and , 2012 - Am Soc Microbiol
     
    3. Structural analysis of a putative family 32 carbohydrate-binding module from the Streptococcus pneumoniae enzyme EndoD
    DW Abbott, A Boraston - Acta Crystallographica Section F: Structural , 2011 - scripts.iucr.org
     
    4. Differences in the Substrate Specificities and Active-Site Structures of Two _-L-Fucosidases (Glycoside Hydrolase Family 29) from Bacteroides thetaiotaomicron
    H SAKURAMA, E TSUTSUMI, H ASHIDA - Bioscience, , 2012 - japanlinkcenter.org
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch