.
The Open Protein Structure Annotation Network
PDB Keyword
.

3ezy

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of probable dehydrogenase TM_0414 from Thermotoga maritima. To be published
    Site NYSGXRC
    PDB Id 3ezy Target Id NYSGXRC-11127d
    Molecular Characteristics
    Source Thermotoga maritima
    Alias Ids TPS24528,3.40.50.720, AAD35499.1 Molecular Weight 37450.86 Da.
    Residues 334 Isoelectric Point 5.50
    Sequence vrigviglgrigtihaenlkmiddailyaisdvredrlremkeklgvekaykdpheliedpnvdavlvc sstnthselviacakakkhvfcekplslnladvdrmieetkkadvilftgfnrrfdrnfkklkeaveng tigkphvlritsrdpapppldyirvsggifldmtihdfdmaryimgeeveevfadgsvlvdeeigkagd vdtavvvlrfksgalgvidnsrravygydqrievfgskgrifadnvrettvvltdeqgdrgsrylyffl eryrdsyleelktfiknvksgeppavsgedgkmalllgyaakksleekrsvkleevig
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.04 Rfree 0.223
    Matthews' coefficent 2.37 Rfactor 0.175
    Waters 600 Solvent Content 48.19

    Ligand Information
    Ligands MRD ((4R)-2-METHYLPENTANE-2,4-DIOL) x 3;MPD ((4S)-2-METHYL-2,4-PENTANEDIOL) x 2
    Metals

    Jmol

     
    Google Scholar output for 3ezy
    1. Structural investigation of myo-inositol dehydrogenase from Bacillus subtilis: implications for catalytic mechanism and inositol dehydrogenase subfamily classification
    K van Straaten, H Zheng, D Palmer, D Sanders - Biochem. J, 2010 - biochemj.org
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch