.
The Open Protein Structure Annotation Network
PDB Keyword
.

3f13

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of putative nudix hydrolase family member from Chromobacterium violaceum. To be Published
    Site NYSGXRC
    PDB Id 3f13 Target Id NYSGXRC-11179g
    Molecular Characteristics
    Source Chromobacterium violaceum
    Alias Ids TPS24540,3.90.79.10, NP_901598.1 Molecular Weight 17600.25 Da.
    Residues 156 Isoelectric Point 9.41
    Sequence mnvledrknerlpsdlarrataiiempdgvlvtasrggrynlpggkanrgelrsqalireireetglri nsmlylfdhitpfnahkvylciaqgqpkpqneierialvsspdtdmdlfvegrailrryarlrneetak gealrallglaryiakvd
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.70 Rfree 0.264
    Matthews' coefficent 2.28 Rfactor 0.221
    Waters 188 Solvent Content 46.03

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch