.
The Open Protein Structure Annotation Network
PDB Keyword
.

3f5d

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of a protein of unknown function from Bacillus subtilis. To be Published
    Site NYSGXRC
    PDB Id 3f5d Target Id NYSGXRC-11172g
    Molecular Characteristics
    Source Bacillus subtilis
    Alias Ids TPS27098,CAB12318.1, 3.40.50.880 Molecular Weight 22420.49 Da.
    Residues 197 Isoelectric Point 5.71
    Sequence vkkalflildqyadwegvylasalnqredwsvhtvsldpivssiggfktsvdyiiglepanfnllvmig gdswsndnkkllhfvktafqknipiaaicgavdflakngllnnhshtgnfvylwkdykqykpissfvek qavrdknlvtangtapieftnlilemidfdtpeniekmmymnrygfyhfcdkygnpfvd
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.06 Rfree 0.257
    Matthews' coefficent 2.25 Rfactor 0.213
    Waters 127 Solvent Content 45.42

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3f5d
    1. Dissection of the dimerization modes in the DJ-1 superfamily
    HJ Jung, S Kim, YJ Kim, MK Kim, SG Kang, JH Lee - Molecules and , 2012 - Springer
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch