.
The Open Protein Structure Annotation Network
PDB Keyword
.

3f5q

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of an uncharacterized protein. to be published
    Site NYSGXRC
    PDB Id 3f5q Target Id NYSGXRC-13837b
    Related PDB Ids 3gz4 
    Molecular Characteristics
    Source Escherichia coli
    Alias Ids TPS26976,AAN80202.1, PF00106 Molecular Weight 27933.42 Da.
    Residues 252 Isoelectric Point 6.31
    Sequence mhyqpkqdllndriilvtgasdgigreaamtyarygatvillgrneeklrqvashineetgrqpqwfil dlltctsedcqqlaqriavnyprldgvlhnagllgdvcpmseqdpqvwqdvmqvnvnatfmltqallpl llksdagslvftsssvgrqgranwgayaaskfategmmqvladeyqqrlrvncinpggtrtamrasafp tedpqklktpadimplylwlmgddsrrktgmtfdaqpgrkpgisq
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.76 Rfree 0.215
    Matthews' coefficent 1.98 Rfactor 0.171
    Waters 362 Solvent Content 37.75

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch