The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title CRYSTAL STRUCTURE OF putatitve short chain dehydrogenase from Shigella flexneri 2a str. 301. To be Published
    Site NYSGXRC
    PDB Id 3f5s Target Id NYSGXRC-13837c
    Related PDB Ids 3gy0 
    Molecular Characteristics
    Source Shigella flexneri
    Alias Ids TPS26978,AAP16771.1, PF00106 Molecular Weight 27973.54 Da.
    Residues 252 Isoelectric Point 7.67
    Sequence mhyqpkqdllndriilvtgasdgigreaamtyarygatvillgrneeklrqvashineetgrqpqwfil dlltctsencqqlaqrivvnyprldgvlhnagllgdvcpmseqnpqvwqdvmqinvnatfmltqallpl llksdagslvftsssvgrqgranwgayaaskfategmmqvladeyqqrlrvncinpggtrtamrasafp tedpqklktpadimplylwlmgddsrrktgmtfdaqpgrkpgisq
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.36 Rfree 0.208
    Matthews' coefficent 1.98 Rfactor 0.184
    Waters 251 Solvent Content 37.76

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch