The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a hydrolase, NUDIX family from Clostridium perfringens. To be Published
    Site NYSGXRC
    PDB Id 3f6a Target Id NYSGXRC-11180h
    Molecular Characteristics
    Source Clostridium perfringens
    Alias Ids TPS27108,, YP_695508.1 Molecular Weight 16833.56 Da.
    Residues 149 Isoelectric Point 5.88
    Sequence mnrhftvsvfivckdkvllhlhkkakkmlplgghievnelpeeacireakeeaglnvtlynpidinlkk scdlsgekllinpihtilgdvspnhshidfvyyatttsfetspeigeskilkwyskedlknahniqeni lvmatealdll
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.02 Rfree 0.263
    Matthews' coefficent 2.12 Rfactor 0.226
    Waters 179 Solvent Content 42.06

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch