.
The Open Protein Structure Annotation Network
PDB Keyword
.

3f6c

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title CRYSTAL STRUCTURE OF N-TERMINAL DOMAIN OF POSITIVE TRANSCRIPTION REGULATOR evgA FROM ESCHERICHIA COLI. To be Published
    Site NYSGXRC
    PDB Id 3f6c Target Id NYSGXRC-11029y
    Molecular Characteristics
    Source Escherichia coli
    Alias Ids TPS27046,3.40.50.2300, EVGA_ECOLI, PF00072 Molecular Weight 22688.94 Da.
    Residues 204 Isoelectric Point 6.83
    Sequence mnaiiiddhplaiaairnllikndieilaelteggsavqrvetlkpdiviidvdipgvngiqvletlrk rqysgiiiivsakndhfygkhcadagangfvskkegmnniiaaieaakngycyfpfslnrfvgsltsdq qkldslskqeisvmryildgkdnndiaekmfisnktvstyksrlmekleckslmdlytfaqrnkig
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.45 Rfree 0.25591
    Matthews' coefficent 2.06 Rfactor 0.21022
    Waters 325 Solvent Content 40.40

    Ligand Information
    Ligands GOL (GLYCEROL) x 1
    Metals

    Jmol

     
    Google Scholar output for 3f6c
    1. Mass spectrometry guided in situ proteolysis to obtain crystals for X-ray structure determination
    T Gheyi, L Rodgers, R Romero, JM Sauder - Journal of the American , 2010 - Elsevier
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch