.
The Open Protein Structure Annotation Network
PDB Keyword
.

3fbg

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a putative arginate lyase from Staphylococcus haemolyticus. To be Published
    Site NYSGXRC
    PDB Id 3fbg Target Id NYSGXRC-11158p
    Molecular Characteristics
    Source Staphylococcus haemolyticus
    Alias Ids TPS27088,YP_252767.1, 3.40.50.720 Molecular Weight 37549.80 Da.
    Residues 336 Isoelectric Point 5.26
    Sequence vkaigfeqpfklsdgnlfktfnldipepkvheilvkiqsisvnpvdtkqrlmdvskaprvlgfdaigvv esvgnevtmfnqgdivyysgspdqngsnaeyqlinerlvakapknisaeqavslpltgitayetlfdvf gisrnrnenegktlliingaggvgsiatqiakayglrvittasrnetiewtkkmgadivlnhkesllnq fktqgielvdyvfctfntdmyyddmiqlvkprghiativafendqdlnalkpkslsfshefmfarplnq tddmikhheyleditnkveqniyqptttkviegltteniyqahqilesntmigklvinln
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.60 Rfree 0.275
    Matthews' coefficent 2.34 Rfactor 0.235
    Waters 585 Solvent Content 47.38

    Ligand Information
    Ligands
    Metals MG (MAGNESIUM) x 3

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch